Maven@piefed.blahaj.zone to Ask Lemmy@lemmy.worldEnglish · 1 month agoWhats the best voice acting in any video game?message-squaremessage-square168linkfedilinkarrow-up1124arrow-down11file-text
arrow-up1123arrow-down1message-squareWhats the best voice acting in any video game?Maven@piefed.blahaj.zone to Ask Lemmy@lemmy.worldEnglish · 1 month agomessage-square168linkfedilinkfile-text
minus-squaremysticpicklelinkfedilinkarrow-up6·1 month agoClair Obscur: Expedition 33 The voice actors really hit it out of the park with this one. But this scene in particular: https://www.youtube.com/watch?v=7RQDMWXEJbE
minus-squareAdamBomb@lemmy.sdf.orglinkfedilinkEnglisharrow-up3·29 days agoSuch a good scene. This is my vote too.
minus-squareBurgerBaron@piefed.sociallinkfedilinkEnglisharrow-up2·29 days agoThe writing matters just as much, but the entire intro sequence not falling flat is some truly skilled work nailing the awkward reunion of two ex lovers.
Clair Obscur: Expedition 33
The voice actors really hit it out of the park with this one. But this scene in particular:
https://www.youtube.com/watch?v=7RQDMWXEJbE
Such a good scene. This is my vote too.
The writing matters just as much, but the entire intro sequence not falling flat is some truly skilled work nailing the awkward reunion of two ex lovers.