T (they/she)@beehaw.org to Linux@lemmy.ml · 5 months agoA word about systemdskarnet.orgexternal-linkmessage-square93fedilinkarrow-up166arrow-down112file-text
arrow-up154arrow-down1external-linkA word about systemdskarnet.orgT (they/she)@beehaw.org to Linux@lemmy.ml · 5 months agomessage-square93fedilinkfile-text
minus-squarecaseyweedermanlinkfedilinkarrow-up7·5 months agoI used Linux during the init.d days. What a nightmare that was.
minus-squareflying_sheep@lemmy.mllinkfedilinkarrow-up2·5 months agoThe only thing I liked was arch’s pretty boot sequence … which I stared at for a while because SysV init was so slow.
I used Linux during the init.d days. What a nightmare that was.
The only thing I liked was arch’s pretty boot sequence … which I stared at for a while because SysV init was so slow.